| Not reconstituted | |
| Bottle type: | Vial – sealed flip top |
| Form: | Powder (lyophilized) |
| Vial size: | 3ML |
| Test results: | |
| FOXO4-DRI | |
| Date Tested: | June 05, 2026 |
| Purity: | 99.678% |
| Weight: | 12.82MG |
| Endotoxins(LPS): | Pass |
| Batch #: | FOX06260210B |
FOXO4-DRI Peptide Information
| FORM | Powder (lyophilized) |
|---|---|
| CAS NUMBER | 2460055-10-9 |
| SEQUENCE | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG |
| OTHER NAMES | FOXO4-DRI |
| WEIGHT | 10mg |
| Molecular Weight | 5358.05 g/mol |
| Terms | Subject to our Terms and Conditions. This material is sold for laboratory research use only. Not for human consumption, animal, or medical use. |
Why isn’t there more information on FOXO4-DRI?
Due to the legal landscape of peptides and research products, providing information that may imply anything beyond laboratory research use is a legal liability. We’re an expert biotechnology company that provides high quality peptides and products for purchase to advance scientific research in this field.
This product is in powder form and is not reconstituted.
The Standard of excellence
We’ve been a trusted source to buy pure peptides since 2020.
Every batch is analytically verified with HPLC to be up to the highest standards in purity, active weight content, and identity.
- Batch number on every vial
- Satisfaction guarantee
- Expert customer service
- Published Certificates of Analysis
- Every batch tested
- Cold pack styrofoam shipping option



Reviews
There are no reviews yet.